Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.14: Fumble-like [159623] (4 proteins) Pfam PF03630; type II pantothenate kinase-like |
Protein Pantothenate kinase 3, PANK3 [159624] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [159625] (3 PDB entries) Uniprot Q9H999 12-152! Uniprot Q9H999 157-368 |
Domain d3smsa2: 3sms A:157-368 [233586] automated match to d2i7na2 complexed with adp, rnh, unx |
PDB Entry: 3sms (more details), 2.2 Å
SCOPe Domain Sequences for d3smsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3smsa2 c.55.1.14 (A:157-368) Pantothenate kinase 3, PANK3 {Human (Homo sapiens) [TaxId: 9606]} qaecyyfanasepercqkmpfnlddpypllvvnigsgvsilavhskdnykrvtgtslggg tflglcslltgcesfeealemaskgdstqadklvrdiyggdyerfglpgwavassfgnmi ykekresvskedlaratlvtitnnigsvarmcavnekinrvvfvgnflrvntlsmkllay aldywskgqlkalflehegyfgavgallglpn
Timeline for d3smsa2: