Lineage for d3rsjb1 (3rsj B:868-1085)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781809Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1781810Protein automated matches [190437] (37 species)
    not a true protein
  7. 1781886Species Clostridium botulinum [TaxId:1491] [225675] (21 PDB entries)
  8. 1781899Domain d3rsjb1: 3rsj B:868-1085 [233497]
    Other proteins in same PDB: d3rsja2, d3rsjb2, d3rsjc2, d3rsjd2
    automated match to d3btaa1

Details for d3rsjb1

PDB Entry: 3rsj (more details), 2 Å

PDB Description: structure of hcrf in complex with ganglioside gd1a
PDB Compounds: (B:) BoNT/F

SCOPe Domain Sequences for d3rsjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rsjb1 b.29.1.0 (B:868-1085) automated matches {Clostridium botulinum [TaxId: 1491]}
dnsildmryennkfidisgygsnisingdvyiystnrnqfgiysskpsevniaqnndiiy
ngryqnfsisfwvripkyfnkvnlnneytiidcirnnnsgwkislnynkiiwtlqdtagn
nqklvfnytqmisisdyinkwifvtitnnrlgnsriyingnlideksisnlgdihvsdni
lfkivgcndtryvgiryfkvfdtelgkteietlysdep

SCOPe Domain Coordinates for d3rsjb1:

Click to download the PDB-style file with coordinates for d3rsjb1.
(The format of our PDB-style files is described here.)

Timeline for d3rsjb1: