Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.16: HIN-2000 domain-like [159141] (2 families) duplication: tandem repeat of two OB-fold domains |
Family b.40.16.0: automated matches [233467] (1 protein) not a true family |
Protein automated matches [233468] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [233469] (2 PDB entries) |
Domain d3rn5b2: 3rn5 B:250-340 [233477] automated match to d2oq0a1 protein/DNA complex; complexed with edo |
PDB Entry: 3rn5 (more details), 2.5 Å
SCOPe Domain Sequences for d3rn5b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rn5b2 b.40.16.0 (B:250-340) automated matches {Human (Homo sapiens) [TaxId: 9606]} pkintlqtqplgtivnglfvvqkvtekkknilfdlsdntgkmevlgvrnedtmkckegdk vrltfftlskngeklqltsgvhstikvikak
Timeline for d3rn5b2: