| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.9: Potassium channel NAD-binding domain [63944] (5 proteins) automatically mapped to Pfam PF02254 |
| Protein automated matches [228498] (1 species) not a true protein |
| Species Methanothermobacter thermautotrophicus [TaxId:187420] [228499] (8 PDB entries) |
| Domain d3rbxa1: 3rbx A:116-244 [233428] Other proteins in same PDB: d3rbxa2, d3rbxb2, d3rbxc2, d3rbxd2, d3rbxe2, d3rbxf2 automated match to d1lnqa3 complexed with ca; mutant |
PDB Entry: 3rbx (more details), 2.8 Å
SCOPe Domain Sequences for d3rbxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rbxa1 c.2.1.9 (A:116-244) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
rhvvicgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptrvsdlekanv
rgaravivnlesdsetihcilgirkidesvriiaeaeryenieqlrmagadqvispfvis
grlmsrsid
Timeline for d3rbxa1: