Lineage for d3rbxa1 (3rbx A:116-244)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845624Family c.2.1.9: Potassium channel NAD-binding domain [63944] (5 proteins)
    automatically mapped to Pfam PF02254
  6. 2845674Protein automated matches [228498] (1 species)
    not a true protein
  7. 2845675Species Methanothermobacter thermautotrophicus [TaxId:187420] [228499] (8 PDB entries)
  8. 2845682Domain d3rbxa1: 3rbx A:116-244 [233428]
    Other proteins in same PDB: d3rbxa2, d3rbxb2, d3rbxc2, d3rbxd2, d3rbxe2, d3rbxf2
    automated match to d1lnqa3
    complexed with ca; mutant

Details for d3rbxa1

PDB Entry: 3rbx (more details), 2.8 Å

PDB Description: MthK RCK domain D184N mutant, Ca2+-bound
PDB Compounds: (A:) Calcium-gated potassium channel mthK

SCOPe Domain Sequences for d3rbxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rbxa1 c.2.1.9 (A:116-244) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
rhvvicgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptrvsdlekanv
rgaravivnlesdsetihcilgirkidesvriiaeaeryenieqlrmagadqvispfvis
grlmsrsid

SCOPe Domain Coordinates for d3rbxa1:

Click to download the PDB-style file with coordinates for d3rbxa1.
(The format of our PDB-style files is described here.)

Timeline for d3rbxa1: