| Class b: All beta proteins [48724] (174 folds) |
| Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) ![]() |
| Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins) the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2 there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus) |
| Protein Insect picorna-like virus coat proteins [49654] (1 species) different genetic order of VP segments due to extensive genome shuffling |
| Species Cricket paralysis virus [TaxId:12136] [49655] (1 PDB entry) |
| Domain d1b35b_: 1b35 B: [23334] |
PDB Entry: 1b35 (more details), 2.4 Å
SCOPe Domain Sequences for d1b35b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b35b_ b.121.4.1 (B:) Insect picorna-like virus coat proteins {Cricket paralysis virus [TaxId: 12136]}
enshienedkrltseqkeivhfvsegvtpsttalpdivnlstnyldkntredrihsikdf
lsrpiiiatnlwsvsdpvekqlytanfpevlisnamyqdklkgfvglratlvvkvqvnsq
pfqqgrlmlqyipyaqympnrvtlinetlqgrsgcprtdlelsvgtevemripyvsphly
ynlitgqgsfgsiyvvvysqlhdqvsgtgsieytvwahledvdvqyptganiftgneayi
kgtsrydaaqkahaa
Timeline for d1b35b_: