SCOPe 2.08: Domain d3pv8d2: 3pv8 D:469-876

Lineage for d3pv8d2 (3pv8 D:469-876)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein automated matches [226972] (9 species)
   not a true protein

7. Species Geobacillus kaustophilus [TaxId:1462] [233275] (8 PDB entries)

8. Domain d3pv8d2: 3pv8 D:469-876 [233276]
   Other proteins in same PDB: d3pv8a1, d3pv8d1
   automated match to d2hhva2
   protein/DNA complex; complexed with d3t, mg, so4

Details for d3pv8d2

PDB Entry: 3pv8, 1.52 Å

PDB Description: crystal structure of bacillus dna polymerase i large fragment bound to dna and ddttp-da in closed conformation

PDB Compounds: (D:) DNA polymerase I

SCOPe Domain Sequences for d3pv8d2:

Sequence; same for both SEQRES and ATOM records:

>d3pv8d2 e.8.1.1 (D:469-876) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
eqdrllveleqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefni
nspkqlgvilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyi
egllkvvrpatkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwl
ifaadysqielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakav
nygivygisdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllh
rrrylpditsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqv
hdelileapkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak

Timeline for d3pv8d2:

• d3pv8d2 first appeared in SCOPe 2.03
  
• d3pv8d2 appears in SCOPe 2.07