Lineage for d3pv8a1 (3pv8 A:298-468)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2887216Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2887217Protein automated matches [190396] (40 species)
    not a true protein
  7. 2887247Species Geobacillus kaustophilus [TaxId:1462] [233272] (8 PDB entries)
  8. 2887256Domain d3pv8a1: 3pv8 A:298-468 [233274]
    Other proteins in same PDB: d3pv8a2, d3pv8d2
    automated match to d1nk4a1
    protein/DNA complex; complexed with d3t, mg, so4

Details for d3pv8a1

PDB Entry: 3pv8 (more details), 1.52 Å

PDB Description: crystal structure of bacillus dna polymerase i large fragment bound to dna and ddttp-da in closed conformation
PDB Compounds: (A:) DNA polymerase I

SCOPe Domain Sequences for d3pv8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pv8a1 c.55.3.0 (A:298-468) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
kmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpqf
vawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakmk
qyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

SCOPe Domain Coordinates for d3pv8a1:

Click to download the PDB-style file with coordinates for d3pv8a1.
(The format of our PDB-style files is described here.)

Timeline for d3pv8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pv8a2