Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins) duplication: consists of two domains of this fold |
Protein automated matches [227006] (3 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [232312] (4 PDB entries) |
Domain d3pgeb1: 3pge B:1-126 [233236] Other proteins in same PDB: d3pgeb2 automated match to d1plqa1 |
PDB Entry: 3pge (more details), 2.8 Å
SCOPe Domain Sequences for d3pgeb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pgeb1 d.131.1.2 (B:1-126) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd idadfl
Timeline for d3pgeb1: