![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
![]() | Family c.23.16.0: automated matches [191336] (1 protein) not a true family |
![]() | Protein automated matches [190197] (23 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [226043] (19 PDB entries) |
![]() | Domain d3p9pb2: 3p9p B:598-753 [233198] Other proteins in same PDB: d3p9pa1, d3p9pb1, d3p9pc1, d3p9pd1 automated match to d1p80a1 complexed with hdd, hde, hem |
PDB Entry: 3p9p (more details), 1.5 Å
SCOPe Domain Sequences for d3p9pb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p9pb2 c.23.16.0 (B:598-753) automated matches {Escherichia coli K-12 [TaxId: 83333]} vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg iveadsadgsfmdelltlmaahrvwsripkidkipa
Timeline for d3p9pb2: