Lineage for d3p9pb1 (3p9p B:28-597)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2570066Fold e.5: Heme-dependent catalase-like [56633] (1 superfamily)
    contains an (8,10) beta-barrel and an all-alpha domain
  4. 2570067Superfamily e.5.1: Heme-dependent catalase-like [56634] (3 families) (S)
  5. 2570068Family e.5.1.1: Heme-dependent catalases [56635] (3 protein domains)
  6. 2570220Protein automated matches [190051] (6 species)
    not a true protein
  7. 2570242Species Escherichia coli K-12 [TaxId:83333] [226042] (19 PDB entries)
  8. 2570280Domain d3p9pb1: 3p9p B:28-597 [233164]
    Other proteins in same PDB: d3p9pa2, d3p9pb2, d3p9pc2, d3p9pd2
    automated match to d1cf9a2
    complexed with hdd, hde, hem

Details for d3p9pb1

PDB Entry: 3p9p (more details), 1.5 Å

PDB Description: structure of i274v variant of e. coli kate
PDB Compounds: (B:) catalase hpii

SCOPe Domain Sequences for d3p9pb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p9pb1 e.5.1.1 (B:28-597) automated matches {Escherichia coli K-12 [TaxId: 83333]}
slapedgshrpaaeptppgaqptapgslkapdtrneklnsledvrkgsenyalttnqgvr
iaddqnslragsrgptlledfilrekithfdheriperivhargsaahgyfqpykslsdi
tkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteegifdlvgnntpiff
iqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvmwamsdrgiprsyr
tmegfgvhtfrlinaegkatfvrfhwkplagkaslvwdeaqkltgrdpdfhrrelweaie
agdfpeyelgfqlipeedefkfdfdlldptklipeelvpvqrvgkmvlnrnpdnffaene
qaafhpghivpgldftndpllqgrlfsytdtqisrlggpnfheipinrptcpyhnfqrdg
mhrmgidtnpanyepnsindnwpretppgpkrggfesyqervegnkvrerspsfgeyysh
prlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqlahidltlaqavaknlgielt
ddqlnitpppdvnglkkdpslslyaipdgd

SCOPe Domain Coordinates for d3p9pb1:

Click to download the PDB-style file with coordinates for d3p9pb1.
(The format of our PDB-style files is described here.)

Timeline for d3p9pb1: