Lineage for d2tbvc_ (2tbv C:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) 
Family b.10.1.2: Plant virus proteins [49616] (16 proteins) 
Protein TBSV coat protein [49633] (1 species) Species Tomato bushy stunt virus [TaxId:12145] [49634] (1 PDB entry) 
Domain d2tbvc_: 2tbv C: [23304]
Details for d2tbvc_
PDB Entry: 2tbv (more details), 2.9 Å
PDB Description: structure of tomato bushy stunt virus. v. coat protein sequence determination and its structural implications
SCOP Domain Sequences for d2tbvc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tbvc_ b.10.1.2 (C:) TBSV coat protein {Tomato bushy stunt virus}
iithvggvggsimapvavsrqlvgskpkftgrtsggvtvtshreyltqvnnssgfvvngg
ivgnslqlnpsngtlfswlpalasnfdqysfnsvvldyvplcgttevgrvalyfdkdsqd
pepadrvelanfgvlketapwaeamlriptdkvkrycndsatvdqklidlgqlgiatygg
agadavgelflarsvtlyfpqptntllsskrldltgsladatgpgylvltrtptvlthtf
ratgtfnlsgglrcltsltlgatgavvindilaidnvgtasdyflnctvsslpatvtftv
sgvaagillvgraranvvnll
SCOP Domain Coordinates for d2tbvc_:
Click to download the PDB-style file with coordinates for d2tbvc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2tbvc_:
- d2tbvc_ first appeared (with stable ids) in SCOP 1.55
- d2tbvc_ appears in SCOP 1.59
- d2tbvc_ appears in SCOP 1.63
- d2tbvc_ appears in the current release, SCOPe 2.08
View in 3D
