| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (67 species) not a true protein |
| Species Actinobacillus succinogenes [TaxId:339671] [225929] (4 PDB entries) |
| Domain d3n6jd1: 3n6j D:8-138 [232986] Other proteins in same PDB: d3n6ja2, d3n6jb2, d3n6jc2, d3n6jd2 automated match to d4g8ta1 |
PDB Entry: 3n6j (more details), 2.4 Å
SCOPe Domain Sequences for d3n6jd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n6jd1 d.54.1.0 (D:8-138) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
vpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatienalt
eaiphvvgrpisilnkivndmhngyldadydtfgkgawtfelrvnavaaleaalldlmgq
flgvpvaellg
Timeline for d3n6jd1: