| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
| Protein automated matches [226923] (45 species) not a true protein |
| Species Chromohalobacter salexigens [TaxId:290398] [232967] (1 PDB entry) |
| Domain d3mznb2: 3mzn B:133-445 [232968] Other proteins in same PDB: d3mzna1, d3mznb1 automated match to d4g8ta2 complexed with act, gol, so4 |
PDB Entry: 3mzn (more details), 1.85 Å
SCOPe Domain Sequences for d3mznb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mznb2 c.1.11.0 (B:133-445) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
qygrqrdevealgylfllgdpdktdlpyprvadpvdawdevryreamtpeavanlaraay
drygfkdfklkggvlrgeeeadciralheafpearlaldpngawkldeavrvlepikhll
syaedpcgqeggfsgretmaefkkrtglptatnmiatdykqlqyavqlnsvdipladchf
wtmqgavavgelcnewgmtwgshsnnhfdislammthvaaacpgeitaidthwiwqdgqr
itrepfqirdgkltvpktpglgieldddklmeahetykrldvtqrndamamqylipgwef
dpkrpalveghhh
Timeline for d3mznb2: