Lineage for d3mznb2 (3mzn B:133-445)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1343755Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1344084Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1344085Protein automated matches [226923] (45 species)
    not a true protein
  7. 1344157Species Chromohalobacter salexigens [TaxId:290398] [232967] (1 PDB entry)
  8. 1344159Domain d3mznb2: 3mzn B:133-445 [232968]
    Other proteins in same PDB: d3mzna1, d3mznb1
    automated match to d4g8ta2
    complexed with act, gol, so4

Details for d3mznb2

PDB Entry: 3mzn (more details), 1.85 Å

PDB Description: crystal structure of probable glucarate dehydratase from chromohalobacter salexigens dsm 3043
PDB Compounds: (B:) glucarate dehydratase

SCOPe Domain Sequences for d3mznb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mznb2 c.1.11.0 (B:133-445) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
qygrqrdevealgylfllgdpdktdlpyprvadpvdawdevryreamtpeavanlaraay
drygfkdfklkggvlrgeeeadciralheafpearlaldpngawkldeavrvlepikhll
syaedpcgqeggfsgretmaefkkrtglptatnmiatdykqlqyavqlnsvdipladchf
wtmqgavavgelcnewgmtwgshsnnhfdislammthvaaacpgeitaidthwiwqdgqr
itrepfqirdgkltvpktpglgieldddklmeahetykrldvtqrndamamqylipgwef
dpkrpalveghhh

SCOPe Domain Coordinates for d3mznb2:

Click to download the PDB-style file with coordinates for d3mznb2.
(The format of our PDB-style files is described here.)

Timeline for d3mznb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mznb1