Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (55 species) not a true protein |
Species Chromohalobacter salexigens [TaxId:290398] [232962] (1 PDB entry) |
Domain d3mzna1: 3mzn A:1-132 [232969] Other proteins in same PDB: d3mzna2, d3mznb2 automated match to d4g8ta1 complexed with act, gol, so4 |
PDB Entry: 3mzn (more details), 1.85 Å
SCOPe Domain Sequences for d3mzna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mzna1 d.54.1.0 (A:1-132) automated matches {Chromohalobacter salexigens [TaxId: 290398]} lfpkitkmnvvpvagedgfllnlsgghepwfircvlvledesgnrgvgeipssegilngl ekcrslvegarvnevkqvlsrargllaqggpeergrqtfdlrvavhvitaiesalfdlfg qalgmpvadllg
Timeline for d3mzna1: