Lineage for d1smvb_ (1smv B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 966111Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 966284Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 966691Family b.121.4.7: Tombusviridae-like VP [88643] (5 proteins)
  6. 966702Protein Sobemovirus coat protein [88644] (4 species)
  7. 966715Species SMV (Sesbania mosaic virus) [TaxId:12558] [49624] (5 PDB entries)
    Uniprot Q9EB06
  8. 966717Domain d1smvb_: 1smv B: [23289]
    complexed with ca

Details for d1smvb_

PDB Entry: 1smv (more details), 3 Å

PDB Description: primary structure of sesbania mosaic virus coat protein: its implications to the assembly and architecture of the virus
PDB Compounds: (B:) sesbania mosaic virus coat protein

SCOPe Domain Sequences for d1smvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smvb_ b.121.4.7 (B:) Sobemovirus coat protein {SMV (Sesbania mosaic virus) [TaxId: 12558]}
gaitvlhceltaeigvtdsivvsselvmpytvgtwlrgvadnwskyswlsvrytyipscp
sstagsihmgfqydmadtvpvsvnklsnlrgyvsgqvwsgsaglcfinnsrcsdtstais
ttldvselgkkwypyktsadyatavgvdvniatdlvparlvialldgssstavaagriyd
tytiqmieptasalnl

SCOPe Domain Coordinates for d1smvb_:

Click to download the PDB-style file with coordinates for d1smvb_.
(The format of our PDB-style files is described here.)

Timeline for d1smvb_: