SCOPe 2.02: Domain d1stme_: 1stm E:

Lineage for d1stme_ (1stm E:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.7: Satellite viruses [88650] (1 family)

5. Family b.121.7.1: Satellite viruses [88651] (3 proteins)

6. Protein SPMV coat protein [49617] (1 species)

7. Species Satellite panicum mosaic virus [TaxId:154834] [49618] (1 PDB entry)

8. Domain d1stme_: 1stm E: [23285]

Details for d1stme_

PDB Entry: 1stm, 1.9 Å

PDB Description: satellite panicum mosaic virus

PDB Compounds: (E:) satellite panicum mosaic virus

SCOPe Domain Sequences for d1stme_:

Sequence; same for both SEQRES and ATOM records:

>d1stme_ b.121.7.1 (E:) SPMV coat protein {Satellite panicum mosaic virus [TaxId: 154834]}
aaatslvydtcyvtlterattsfqrqsfptlkgmgdrafqvvaftiqgvsaaplmynarl
ynpgdtdsvhatgvqlmgtvprtvrltprvgqnnwffgnteeaetilaidglvstkgana
psntvivtgcfrlapselqss

Timeline for d1stme_:

• d1stme_ first appeared (with stable ids) in SCOP 1.55
  
• d1stme_ appears in SCOPe 2.01
  
• d1stme_ appears in SCOPe 2.03
  
• d1stme_ appears in the current release, SCOPe 2.08