Class b: All beta proteins [48724] (174 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.7: Satellite viruses [88650] (1 family) |
Family b.121.7.1: Satellite viruses [88651] (3 proteins) |
Protein SPMV coat protein [49617] (1 species) |
Species Satellite panicum mosaic virus [TaxId:154834] [49618] (1 PDB entry) |
Domain d1stme_: 1stm E: [23285] |
PDB Entry: 1stm (more details), 1.9 Å
SCOPe Domain Sequences for d1stme_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1stme_ b.121.7.1 (E:) SPMV coat protein {Satellite panicum mosaic virus [TaxId: 154834]} aaatslvydtcyvtlterattsfqrqsfptlkgmgdrafqvvaftiqgvsaaplmynarl ynpgdtdsvhatgvqlmgtvprtvrltprvgqnnwffgnteeaetilaidglvstkgana psntvivtgcfrlapselqss
Timeline for d1stme_:
View in 3D Domains from other chains: (mouse over for more information) d1stma_, d1stmb_, d1stmc_, d1stmd_ |