Class a: All alpha proteins [46456] (285 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families) contains one classic and one pseudo HhH motifs |
Family a.60.4.1: DNA repair protein Rad51, N-terminal domain [47795] (1 protein) |
Protein DNA repair protein Rad51, N-terminal domain [47796] (7 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109871] (2 PDB entries) Uniprot P25454 81-395 |
Domain d3ldaa1: 3lda A:78-144 [232824] Other proteins in same PDB: d3ldaa2 automated match to d1szpa1 complexed with cl; mutant |
PDB Entry: 3lda (more details), 2.5 Å
SCOPe Domain Sequences for d3ldaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ldaa1 a.60.4.1 (A:78-144) DNA repair protein Rad51, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} gsfvpieklqvngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaa rlvpmgf
Timeline for d3ldaa1: