SCOPe 2.05: Domain d3kxda2: 3kxd A:245-339

Lineage for d3kxda2 (3kxd A:245-339)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily)
   beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold

4. Superfamily d.286.1: TrkA C-terminal domain-like [116726] (2 families)

5. Family d.286.1.0: automated matches [228502] (1 protein)
   not a true family

6. Protein automated matches [228504] (1 species)
   not a true protein

7. Species Methanothermobacter thermautotrophicus [TaxId:187420] [228505] (8 PDB entries)

8. Domain d3kxda2: 3kxd A:245-339 [232736]
   Other proteins in same PDB: d3kxda1, d3kxdb1
   automated match to d2fy8a2
   protein/RNA complex; complexed with cd

Details for d3kxda2

PDB Entry: 3kxd, 2.2 Å

PDB Description: Crystal structure of the mthk rck in complex with cadmium

PDB Compounds: (A:) Calcium-gated potassium channel mthK

SCOPe Domain Sequences for d3kxda2:

Sequence; same for both SEQRES and ATOM records:

>d3kxda2 d.286.1.0 (A:245-339) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
dgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgdelii
dpprdysfragdiilgigkpeeierlknyisalvp

Timeline for d3kxda2:

• d3kxda2 first appeared in SCOPe 2.03
  
• d3kxda2 appears in SCOPe 2.04
  
• d3kxda2 appears in SCOPe 2.06
  
• d3kxda2 appears in the current release, SCOPe 2.08