Lineage for d3kura_ (3kur A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1751697Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 1751698Superfamily a.144.1: PABC (PABP) domain [63570] (2 families) (S)
  5. 1751699Family a.144.1.1: PABC (PABP) domain [63571] (3 proteins)
  6. 1751712Protein automated matches [191271] (2 species)
    not a true protein
  7. 1751713Species Human (Homo sapiens) [TaxId:9606] [226585] (4 PDB entries)
  8. 1751718Domain d3kura_: 3kur A: [232732]
    automated match to d4iveb_
    complexed with cl

Details for d3kura_

PDB Entry: 3kur (more details), 2.5 Å

PDB Description: Crystal structure of the MLLE domain of poly(A)-binding protein
PDB Compounds: (A:) polyadenylate-binding protein 1

SCOPe Domain Sequences for d3kura_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kura_ a.144.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pltasmlasappqeqkqmlgerlfpliqamhptlagkitgmlleidnsellhmlespesl
rskvdeavavlqa

SCOPe Domain Coordinates for d3kura_:

Click to download the PDB-style file with coordinates for d3kura_.
(The format of our PDB-style files is described here.)

Timeline for d3kura_: