SCOPe 2.03: Domain d2bpa1_: 2bpa 1:

Lineage for d2bpa1_ (2bpa 1:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.5: ssDNA viruses [88645] (3 families)

5. Family b.121.5.1: Microviridae-like VP [49612] (1 protein)

6. Protein Microvirus capsid proteins [49613] (3 species)
   include capsid protein F and spike protein G

7. Species Bacteriophage phi-X174 [TaxId:10847] [49614] (4 PDB entries)

8. Domain d2bpa1_: 2bpa 1: [23272]
   protein/DNA complex

Details for d2bpa1_

PDB Entry: 2bpa, 3 Å

PDB Description: atomic structure of single-stranded dna bacteriophage phix174 and its functional implications

PDB Compounds: (1:) protein (subunit of bacteriophage phix174)

SCOPe Domain Sequences for d2bpa1_:

Sequence; same for both SEQRES and ATOM records:

>d2bpa1_ b.121.5.1 (1:) Microvirus capsid proteins {Bacteriophage phi-X174 [TaxId: 10847]}
sniqtgaermphdlshlgflagqigrlitisttpviagdsfemdavgalrlsplrrglai
dstvdiftfyvphrhvygeqwikfmkdgvnatplptvnttgyidhaaflgtinpdtnkip
khlfqgylniynnyfkapwmpdrteanpnelnqddarygfrcchlkniwtaplppetels
rqmttsttsidimglqaayanlhtdqerdyfmqryrdvissfggktsydadnrpllvmrs
nlwasgydvdgtdqtslgqfsgrvqqtykhsvprffvpehgtmftlalvrfpptatkeiq
ylnakgaltytdiagdpvlygnlppreismkdvfrsgdsskkfkiaegqwyryapsyvsp
ayhllegfpfiqeppsgdlqervlirhhdydqcfqsvqllqwnsqvkfnvtvyrnlpttr
dsimts

Timeline for d2bpa1_:

• d2bpa1_ first appeared (with stable ids) in SCOP 1.55
  
• d2bpa1_ appears in SCOPe 2.02
  
• d2bpa1_ appears in SCOPe 2.04
  
• d2bpa1_ appears in the current release, SCOPe 2.08