PDB entry 2bpa

View 2bpa on RCSB PDB site
Description: atomic structure of single-stranded DNA bacteriophage phix174 and its functional implications
Class: Virus/DNA
Keywords: PROTEIN-DNA COMPLEX, SINGLE STRAND, Icosahedral virus, Virus/DNA COMPLEX
Deposited on 1991-12-03, released 1991-12-03
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.209
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: protein (subunit of bacteriophage phix174)
    Species: Enterobacteria phage phiX174 sensu lato [TaxId:10847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03641 (0-425)
      • conflict (215)
    Domains in SCOPe 2.03: d2bpa1_
  • Chain '2':
    Compound: protein (subunit of bacteriophage phix174)
    Species: Enterobacteria phage phiX174 sensu lato [TaxId:10847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2bpa2_
  • Chain '3':
    Compound: protein (subunit of bacteriophage phix174)
    Species: Enterobacteria phage phiX174 sensu lato [TaxId:10847]
    Database cross-references and differences (RAF-indexed):
  • Chain 'A':
    Compound: DNA (5'-d(*ap*ap*ap*ap*c)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bpa1 (1:)
    sniqtgaermphdlshlgflagqigrlitisttpviagdsfemdavgalrlsplrrglai
    dstvdiftfyvphrhvygeqwikfmkdgvnatplptvnttgyidhaaflgtinpdtnkip
    khlfqgylniynnyfkapwmpdrteanpnelnqddarygfrcchlkniwtaplppetels
    rqmttsttsidimglqaayanlhtdqerdyfmqryrdvissfggktsydadnrpllvmrs
    nlwasgydvdgtdqtslgqfsgrvqqtykhsvprffvpehgtmftlalvrfpptatkeiq
    ylnakgaltytdiagdpvlygnlppreismkdvfrsgdsskkfkiaegqwyryapsyvsp
    ayhllegfpfiqeppsgdlqervlirhhdydqcfqsvqllqwnsqvkfnvtvyrnlpttr
    dsimts
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bpa2 (2:)
    mfqtfisrhnsnffsdklvltsvtpassapvlqtpkatsstlyfdsltvnagnggflhci
    qmdtsvnaanqvvsvgadiafdadpkffaclvrfesssvpttlptaydvyplngrhdggy
    ytvkdcvtidvlprtpgnnvyvgfmvwsnftatkcrglvslnqvikeiiclqplk
    

  • Chain '3':
    No sequence available.

  • Chain 'A':
    No sequence available.