Class a: All alpha proteins [46456] (290 folds) |
Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
Superfamily a.5.2: UBA-like [46934] (5 families) |
Family a.5.2.1: UBA domain [46935] (25 proteins) |
Protein Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain [140327] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [140328] (10 PDB entries) Uniprot P61086 157-198 |
Domain d3k9oa2: 3k9o A:157-200 [232700] Other proteins in same PDB: d3k9oa1, d3k9ob_ automated match to d1ylaa1 |
PDB Entry: 3k9o (more details), 1.8 Å
SCOPe Domain Sequences for d3k9oa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k9oa2 a.5.2.1 (A:157-200) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} vsspeytkkienlcamgfdrnavivalsskswdvetatelllsn
Timeline for d3k9oa2: