Lineage for d3k9oa2 (3k9o A:157-200)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696009Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2696033Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 2696034Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 2696120Protein Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain [140327] (1 species)
  7. 2696121Species Human (Homo sapiens) [TaxId:9606] [140328] (10 PDB entries)
    Uniprot P61086 157-198
  8. 2696122Domain d3k9oa2: 3k9o A:157-200 [232700]
    Other proteins in same PDB: d3k9oa1, d3k9ob_
    automated match to d1ylaa1

Details for d3k9oa2

PDB Entry: 3k9o (more details), 1.8 Å

PDB Description: The crystal structure of E2-25K and UBB+1 complex
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 K

SCOPe Domain Sequences for d3k9oa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k9oa2 a.5.2.1 (A:157-200) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vsspeytkkienlcamgfdrnavivalsskswdvetatelllsn

SCOPe Domain Coordinates for d3k9oa2:

Click to download the PDB-style file with coordinates for d3k9oa2.
(The format of our PDB-style files is described here.)

Timeline for d3k9oa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3k9oa1
View in 3D
Domains from other chains:
(mouse over for more information)
d3k9ob_