SCOPe 2.04: Domain d1flla1: 1fll A:350-504

Lineage for d1flla1 (1fll A:350-504)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.8: TRAF domain-like [49598] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.8.1: TRAF domain-like [49599] (3 families)
   has a circularly permuted immunoglobulin-fold topology with extra strand

5. Family b.8.1.1: MATH domain [49600] (4 proteins)
   automatically mapped to Pfam PF00917

6. Protein TNF receptor associated factor 3 (TRAF3) [49603] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49604] (5 PDB entries)
   Uniprot Q13114 377-568

8. Domain d1flla1: 1fll A:350-504 [23264]
   Other proteins in same PDB: d1flla2, d1fllb2

Details for d1flla1

PDB Entry: 1fll, 3.5 Å

PDB Description: molecular basis for cd40 signaling mediated by traf3

PDB Compounds: (A:) tnf receptor associated factor 3

SCOPe Domain Sequences for d1flla1:

Sequence; same for both SEQRES and ATOM records:

>d1flla1 b.8.1.1 (A:350-504) TNF receptor associated factor 3 (TRAF3) {Human (Homo sapiens) [TaxId: 9606]}
yngvliwkirdykrrkqeavmgktlslysqpfytgyfgykmcarvylngdgmgkgthlsl
ffvimrgeydallpwpfkqkvtlmlmdqgssrrhlgdafkpdpnsssfkkptgemniasg
cpvfvaqtvlengtyikddtifikvivdtsdlpdp

Timeline for d1flla1:

• d1flla1 first appeared (with stable ids) in SCOP 1.55
  
• d1flla1 appears in SCOPe 2.03
  
• d1flla1 appears in SCOPe 2.05
  
• d1flla1 appears in the current release, SCOPe 2.08