Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
Protein automated matches [190857] (70 species) not a true protein |
Species Escherichia coli [TaxId:562] [225496] (22 PDB entries) |
Domain d3it9a1: 3it9 A:5-258 [232619] Other proteins in same PDB: d3it9a2, d3it9b2, d3it9c2, d3it9d2 automated match to d1nj4a2 complexed with so4, suc |
PDB Entry: 3it9 (more details), 2.1 Å
SCOPe Domain Sequences for d3it9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3it9a1 e.3.1.0 (A:5-258) automated matches {Escherichia coli [TaxId: 562]} tveapsvdarawilmdyasgkvlaegnadekldpasltkimtsyvvgqalkadkikltdm vtvgkdawatgnpalrgssvmflkpgdqvsvadlnkgviiqsgndacialadyvagsqes figlmngyakklgltnttfqtvhgldapgqfstardmallgkalihdvpeeyaihkekef tfnkirqpnrnrllwssnlnvdgmktgttagagynlvasatqgdmrlisvvlgaktdrir fneseklltwgfrf
Timeline for d3it9a1: