Lineage for d3ih2a2 (3ih2 A:76-200)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008141Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2008142Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2008143Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 protein domains)
  6. 2008425Protein Transcriptional regulator TM1030 [140877] (1 species)
  7. 2008426Species Thermotoga maritima [TaxId:2336] [140878] (8 PDB entries)
    Uniprot Q9X0C0 76-200
  8. 2008435Domain d3ih2a2: 3ih2 A:76-200 [232606]
    Other proteins in same PDB: d3ih2a1, d3ih2a3
    automated match to d2id6a2

Details for d3ih2a2

PDB Entry: 3ih2 (more details), 2.3 Å

PDB Description: TM1030 crystallized at 323K
PDB Compounds: (A:) TRANSCRIPTIONAL REGULATOR, TetR FAMILY

SCOPe Domain Sequences for d3ih2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ih2a2 a.121.1.1 (A:76-200) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]}
rdifdfmerwiekkleysashpeeadflitlvsvdeglrkrilldleksqrvffdfvrek
lkdldlaedvteeialkflmwffsgfeevylrtyqgkpellkrdmntlveevkvmlrilk
kgmtk

SCOPe Domain Coordinates for d3ih2a2:

Click to download the PDB-style file with coordinates for d3ih2a2.
(The format of our PDB-style files is described here.)

Timeline for d3ih2a2: