| Class b: All beta proteins [48724] (176 folds) |
| Fold b.8: TRAF domain-like [49598] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.8.1: TRAF domain-like [49599] (3 families) ![]() has a circularly permuted immunoglobulin-fold topology with extra strand |
| Family b.8.1.1: MATH domain [49600] (4 proteins) automatically mapped to Pfam PF00917 |
| Protein TNF receptor associated factor 2 (TRAF2) [49601] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49602] (10 PDB entries) |
| Domain d1czzb1: 1czz B:350-501 [23260] Other proteins in same PDB: d1czza2, d1czzb2, d1czzc2 |
PDB Entry: 1czz (more details), 2.7 Å
SCOPe Domain Sequences for d1czzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1czzb1 b.8.1.1 (B:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]}
ydgvfiwkisdfprkrqeavagripaifspafytsrygykmclriylngdgtgrgthlsl
ffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvtsssfqrpvndmniasgc
plfcpvskmeaknsyvrddaifikaivdltgl
Timeline for d1czzb1:
View in 3DDomains from other chains: (mouse over for more information) d1czza1, d1czza2, d1czzc1, d1czzc2 |