SCOPe 2.08: Domain d1d0jf1: 1d0j F:350-501

Lineage for d1d0jf1 (1d0j F:350-501)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.8: TRAF domain-like [49598] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.8.1: TRAF domain-like [49599] (3 families)
   has a circularly permuted immunoglobulin-fold topology with extra strand

5. Family b.8.1.1: MATH domain [49600] (5 proteins)
   automatically mapped to Pfam PF00917

6. Protein TNF receptor associated factor 2 (TRAF2) [49601] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49602] (10 PDB entries)

8. Domain d1d0jf1: 1d0j F:350-501 [23258]
   Other proteins in same PDB: d1d0ja2, d1d0jb2, d1d0jc2, d1d0jd2, d1d0je2, d1d0jf2

Details for d1d0jf1

PDB Entry: 1d0j, 2.5 Å

PDB Description: structure of tnf receptor associated factor 2 in complex with a m4-1bb peptide

PDB Compounds: (F:) tumor necrosis factor receptor associated protein 2

SCOPe Domain Sequences for d1d0jf1:

Sequence; same for both SEQRES and ATOM records:

>d1d0jf1 b.8.1.1 (F:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]}
ydgvfiwkisdfarkrqeavagripaifspafytsrygykmclriylngdgtgrgthlsl
ffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvtsssfqrpvndmniasgc
plfcpvskmeaknsyvrddaifikaivdltgl

Timeline for d1d0jf1:

• d1d0jf1 first appeared (with stable ids) in SCOP 1.55
  
• d1d0jf1 appears in SCOPe 2.07