PDB entry 1d0j

View 1d0j on RCSB PDB site
Description: structure of tnf receptor associated factor 2 in complex with a m4-1bb peptide
Class: apoptosis
Keywords: b-sandwich, protein-peptide complex, apoptosis
Deposited on 1999-09-10, released 2000-03-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: tumor necrosis factor receptor associated protein 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12933 (0-167)
  Domains in SCOPe 2.08: d1d0ja1, d1d0ja2
• Chain 'B':
  Compound: tumor necrosis factor receptor associated protein 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12933 (0-167)
  Domains in SCOPe 2.08: d1d0jb1, d1d0jb2
• Chain 'C':
  Compound: tumor necrosis factor receptor associated protein 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12933 (0-167)
  Domains in SCOPe 2.08: d1d0jc1, d1d0jc2
• Chain 'D':
  Compound: tumor necrosis factor receptor associated protein 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12933 (0-167)
  Domains in SCOPe 2.08: d1d0jd1, d1d0jd2
• Chain 'E':
  Compound: tumor necrosis factor receptor associated protein 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12933 (0-167)
  Domains in SCOPe 2.08: d1d0je1, d1d0je2
• Chain 'F':
  Compound: tumor necrosis factor receptor associated protein 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12933 (0-167)
  Domains in SCOPe 2.08: d1d0jf1, d1d0jf2
• Chain 'G':
  Compound: 4-1bb ligand receptor
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P20334 (Start-5)
• Chain 'H':
  Compound: 4-1bb ligand receptor
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P20334 (Start-5)
• Chain 'I':
  Compound: 4-1bb ligand receptor
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P20334 (0-5)
• Chain 'J':
  Compound: 4-1bb ligand receptor
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P20334 (0-5)
• Chain 'K':
  Compound: 4-1bb ligand receptor
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P20334 (Start-5)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d0jA (A:)
  amadleqkvlemeastydgvfiwkisdfarkrqeavagripaifspafytsrygykmclr
  iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
  ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d0jB (B:)
  amadleqkvlemeastydgvfiwkisdfarkrqeavagripaifspafytsrygykmclr
  iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
  ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d0jC (C:)
  amadleqkvlemeastydgvfiwkisdfarkrqeavagripaifspafytsrygykmclr
  iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
  ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d0jD (D:)
  amadleqkvlemeastydgvfiwkisdfarkrqeavagripaifspafytsrygykmclr
  iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
  ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d0jE (E:)
  amadleqkvlemeastydgvfiwkisdfarkrqeavagripaifspafytsrygykmclr
  iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
  ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d0jF (F:)
  amadleqkvlemeastydgvfiwkisdfarkrqeavagripaifspafytsrygykmclr
  iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
  ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
  

  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.