PDB entry 1d0j

View 1d0j on RCSB PDB site
Description: structure of tnf receptor associated factor 2 in complex with a m4-1bb peptide
Class: apoptosis
Keywords: b-sandwich, protein-peptide complex, apoptosis
Deposited on 1999-09-10, released 2000-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tumor necrosis factor receptor associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d0ja1, d1d0ja2
  • Chain 'B':
    Compound: tumor necrosis factor receptor associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d0jb1, d1d0jb2
  • Chain 'C':
    Compound: tumor necrosis factor receptor associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d0jc1, d1d0jc2
  • Chain 'D':
    Compound: tumor necrosis factor receptor associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d0jd1, d1d0jd2
  • Chain 'E':
    Compound: tumor necrosis factor receptor associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d0je1, d1d0je2
  • Chain 'F':
    Compound: tumor necrosis factor receptor associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d0jf1, d1d0jf2
  • Chain 'G':
    Compound: 4-1bb ligand receptor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 4-1bb ligand receptor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: 4-1bb ligand receptor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: 4-1bb ligand receptor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: 4-1bb ligand receptor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d0jA (A:)
    amadleqkvlemeastydgvfiwkisdfarkrqeavagripaifspafytsrygykmclr
    iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
    ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d0jB (B:)
    amadleqkvlemeastydgvfiwkisdfarkrqeavagripaifspafytsrygykmclr
    iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
    ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d0jC (C:)
    amadleqkvlemeastydgvfiwkisdfarkrqeavagripaifspafytsrygykmclr
    iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
    ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d0jD (D:)
    amadleqkvlemeastydgvfiwkisdfarkrqeavagripaifspafytsrygykmclr
    iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
    ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d0jE (E:)
    amadleqkvlemeastydgvfiwkisdfarkrqeavagripaifspafytsrygykmclr
    iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
    ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d0jF (F:)
    amadleqkvlemeastydgvfiwkisdfarkrqeavagripaifspafytsrygykmclr
    iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
    ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.