Class a: All alpha proteins [46456] (290 folds) |
Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different |
Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) |
Family a.6.1.3: DNA-binding N-terminal domain of transcription activators [46962] (5 proteins) includes a dimerisation, antiparallel coiled-coil subdomain |
Protein automated matches [232569] (1 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [232570] (4 PDB entries) |
Domain d3iaoa1: 3iao A:1-120 [232571] Other proteins in same PDB: d3iaoa2 automated match to d1r8ea1 |
PDB Entry: 3iao (more details), 2.8 Å
SCOPe Domain Sequences for d3iaoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iaoa1 a.6.1.3 (A:1-120) automated matches {Bacillus subtilis [TaxId: 1423]} mkesyysigevsklanvsikalryydkidlfkpayvdpdtsyryytdsqlihldlikslk yigtpleemkkaqdlemeelfafyteqerqirekldflsaleqtislvkkrmkrqmeypa
Timeline for d3iaoa1: