SCOPe 2.08: Domain d3iaoa1: 3iao A:1-120

Lineage for d3iaoa1 (3iao A:1-120)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
   core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families)

5. Family a.6.1.3: DNA-binding N-terminal domain of transcription activators [46962] (5 proteins)
   includes a dimerisation, antiparallel coiled-coil subdomain

6. Protein automated matches [232569] (1 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [232570] (4 PDB entries)

8. Domain d3iaoa1: 3iao A:1-120 [232571]
   Other proteins in same PDB: d3iaoa2
   automated match to d1r8ea1

Details for d3iaoa1

PDB Entry: 3iao, 2.8 Å

PDB Description: conformational plasticity of the coiled coil domain of bmrr is required for bmr promoter binding-the unliganded structure of bmrr

PDB Compounds: (A:) Multidrug-efflux transporter 1 regulator

SCOPe Domain Sequences for d3iaoa1:

Sequence; same for both SEQRES and ATOM records:

>d3iaoa1 a.6.1.3 (A:1-120) automated matches {Bacillus subtilis [TaxId: 1423]}
mkesyysigevsklanvsikalryydkidlfkpayvdpdtsyryytdsqlihldlikslk
yigtpleemkkaqdlemeelfafyteqerqirekldflsaleqtislvkkrmkrqmeypa

Timeline for d3iaoa1:

• d3iaoa1 first appeared in SCOPe 2.03
  
• d3iaoa1 appears in SCOPe 2.07