Lineage for d1ca4b1 (1ca4 B:350-501)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1529540Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1529541Superfamily b.8.1: TRAF domain-like [49599] (3 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. 1529542Family b.8.1.1: MATH domain [49600] (4 proteins)
    automatically mapped to Pfam PF00917
  6. 1529558Protein TNF receptor associated factor 2 (TRAF2) [49601] (1 species)
  7. 1529559Species Human (Homo sapiens) [TaxId:9606] [49602] (10 PDB entries)
  8. 1529585Domain d1ca4b1: 1ca4 B:350-501 [23239]
    Other proteins in same PDB: d1ca4a2, d1ca4b2, d1ca4c2, d1ca4d2, d1ca4e2, d1ca4f2

Details for d1ca4b1

PDB Entry: 1ca4 (more details), 2.2 Å

PDB Description: structure of tnf receptor associated factor 2 (traf2)
PDB Compounds: (B:) protein (tnf receptor associated factor 2)

SCOPe Domain Sequences for d1ca4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ca4b1 b.8.1.1 (B:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]}
ydgvfiwkisdfarkrqeavagripaifspafytsrygykmclriylngdgtgrgthlsl
ffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvtsssfqrpvndmniasgc
plfcpvskmeaknsyvrddaifikaivdltgl

SCOPe Domain Coordinates for d1ca4b1:

Click to download the PDB-style file with coordinates for d1ca4b1.
(The format of our PDB-style files is described here.)

Timeline for d1ca4b1: