Lineage for d1d00g1 (1d00 G:350-501)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2382978Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2382979Superfamily b.8.1: TRAF domain-like [49599] (3 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. 2382980Family b.8.1.1: MATH domain [49600] (5 proteins)
    automatically mapped to Pfam PF00917
  6. 2383014Protein TNF receptor associated factor 2 (TRAF2) [49601] (1 species)
  7. 2383015Species Human (Homo sapiens) [TaxId:9606] [49602] (10 PDB entries)
  8. 2383047Domain d1d00g1: 1d00 G:350-501 [23235]
    Other proteins in same PDB: d1d00a2, d1d00b2, d1d00c2, d1d00d2, d1d00e2, d1d00f2, d1d00g2, d1d00h2

Details for d1d00g1

PDB Entry: 1d00 (more details), 2 Å

PDB Description: structure of tnf receptor associated factor 2 in complex with a 5- residue cd40 peptide
PDB Compounds: (G:) tumor necrosis factor receptor associated protein 2

SCOPe Domain Sequences for d1d00g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d00g1 b.8.1.1 (G:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]}
ydgvfiwkisdfarkrqeavagripaifspafytsrygykmclriylngdgtgrgthlsl
ffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvtsssfqrpvndmniasgc
plfcpvskmeaknsyvrddaifikaivdltgl

SCOPe Domain Coordinates for d1d00g1:

Click to download the PDB-style file with coordinates for d1d00g1.
(The format of our PDB-style files is described here.)

Timeline for d1d00g1: