SCOPe 2.06: Domain d3gv8b2: 3gv8 B:300-414

Lineage for d3gv8b2 (3gv8 B:300-414)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families)

5. Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)

6. Protein DNA polymerase iota [111015] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [111016] (19 PDB entries)
   Uniprot Q9UNA4

8. Domain d3gv8b2: 3gv8 B:300-414 [232322]
   Other proteins in same PDB: d3gv8b1
   automated match to d2dpia1
   protein/DNA complex; complexed with dgt, mg

Details for d3gv8b2

PDB Entry: 3gv8, 2 Å

PDB Description: human dna polymerase iota in complex with t template dna and incoming dgtp

PDB Compounds: (B:) DNA polymerase iota

SCOPe Domain Sequences for d3gv8b2:

Sequence, based on SEQRES records:

>d3gv8b2 d.240.1.1 (B:300-414) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]}
qsfseedsfkkcsseveaknkieellasllnrvcqdgrkphtvrliirryssekhygres
rqcpipshviqklgtgnydvmtpmvdilmklfrnmvnvkmpfhltllsvcfcnlk

Sequence, based on observed residues (ATOM records):

>d3gv8b2 d.240.1.1 (B:300-414) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]}
qsfseedsfkkcsseveaknkieellasllnrvcrkphtvrliirrygresrqcpipshv
iqkdvmtpmvdilmklfrnmvnvkmpfhltllsvcfcnlk

Timeline for d3gv8b2:

• d3gv8b2 first appeared in SCOPe 2.03
  
• d3gv8b2 appears in SCOPe 2.05
  
• d3gv8b2 appears in SCOPe 2.07
  
• d3gv8b2 appears in the current release, SCOPe 2.08