Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily) beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology |
Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) |
Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins) |
Protein DNA polymerase iota [111015] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [111016] (19 PDB entries) Uniprot Q9UNA4 |
Domain d3gv5d2: 3gv5 D:300-415 [232320] Other proteins in same PDB: d3gv5b1, d3gv5d1 automated match to d2dpia1 protein/DNA complex; complexed with adi, ca, gol |
PDB Entry: 3gv5 (more details), 2 Å
SCOPe Domain Sequences for d3gv5d2:
Sequence, based on SEQRES records: (download)
>d3gv5d2 d.240.1.1 (D:300-415) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]} qsfseedsfkkcsseveaknkieellasllnrvcqdgrkphtvrliirryssekhygres rqcpipshviqklgtgnydvmtpmvdilmklfrnmvnvkmpfhltllsvcfcnlka
>d3gv5d2 d.240.1.1 (D:300-415) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]} qsfseedsfkkcsseveaknkieellasllnrvcqdgrkphtvrliirryssgresrqcp ipshviqklnydvmtpmvdilmklfrnmvnvkmpfhltllsvcfcnlka
Timeline for d3gv5d2: