Lineage for d1d0ae1 (1d0a E:350-501)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.8: TRAF domain-like [49598] (1 superfamily)
sandwich; 8 strands in 2 sheets; greek-keySuperfamily b.8.1: TRAF domain-like [49599] (3 families) 
has a circularly permuted immunoglobulin-fold topology with extra strandFamily b.8.1.1: MATH domain [49600] (5 proteins)
automatically mapped to Pfam PF00917
Protein TNF receptor associated factor 2 (TRAF2) [49601] (1 species) Species Human (Homo sapiens) [TaxId:9606] [49602] (10 PDB entries) 
Domain d1d0ae1: 1d0a E:350-501 [23227]
Other proteins in same PDB: d1d0aa2, d1d0ab2, d1d0ac2, d1d0ad2, d1d0ae2, d1d0af2
Details for d1d0ae1
PDB Entry: 1d0a (more details), 2 Å
PDB Description: structure of tnf receptor associated factor 2 (traf2) in complex with a human ox40 peptide
PDB Compounds: (E:) tumor necrosis factor receptor associated protein 2SCOPe Domain Sequences for d1d0ae1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d0ae1 b.8.1.1 (E:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]}
ydgvfiwkisdfprkrqeavagripaifspafytsrygykmclriylngdgtgrgthlsl
ffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvtsssfqrpvndmniasgc
plfcpvskmeaknsyvrddaifikaivdltgl
SCOPe Domain Coordinates for d1d0ae1:
Click to download the PDB-style file with coordinates for d1d0ae1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d0ae1:
View in 3D
