Lineage for d3g6xa1 (3g6x A:25-299)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246832Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2246833Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2248370Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins)
    contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
  6. 2248448Protein DNA polymerase iota [111295] (1 species)
  7. 2248449Species Human (Homo sapiens) [TaxId:9606] [111296] (19 PDB entries)
    Uniprot Q9UNA4
  8. 2248454Domain d3g6xa1: 3g6x A:25-299 [232245]
    Other proteins in same PDB: d3g6xa2
    automated match to d2dpja2
    protein/DNA complex; complexed with dgt, mg

Details for d3g6xa1

PDB Entry: 3g6x (more details), 2.08 Å

PDB Description: ternary complex of dna polymerase iota:dna:dgtp with an abasic site at the templating position
PDB Compounds: (A:) DNA polymerase iota

SCOPe Domain Sequences for d3g6xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g6xa1 e.8.1.7 (A:25-299) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]}
assrvivhvdldcfyaqvemisnpelkdkplgvqqkylvvtcnyearklgvkklmnvrda
kekcpqlvlvngedltryremsykvtelleefspvverlgfdenfvdltemvekrlqqlq
sdelsavtvsghvynnqsinlldvlhirllvgsqiaaemreamynqlgltgcagvasnkl
laklvsgvfkpnqqtvllpescqhlihslnhikeipgigyktakclealginsvrdlqtf
spkilekelgisvaqriqklsfgednspvilsgpp

SCOPe Domain Coordinates for d3g6xa1:

Click to download the PDB-style file with coordinates for d3g6xa1.
(The format of our PDB-style files is described here.)

Timeline for d3g6xa1: