| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) ![]() |
| Family a.211.1.2: PDEase [48548] (7 proteins) Pfam PF00233; multihelical; can be divided into three subdomains |
| Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [89152] (35 PDB entries) Uniprot Q08499 388-713 |
| Domain d3g4lc_: 3g4l C: [232241] automated match to d3g4id_ complexed with edo, mg, rof, so4, zn |
PDB Entry: 3g4l (more details), 2.5 Å
SCOPe Domain Sequences for d3g4lc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g4lc_ a.211.1.2 (C:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
dlvhpdaqdildtlednrewyqstip
Timeline for d3g4lc_: