Lineage for d3fzha2 (3fzh A:189-381)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1373353Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1373354Protein automated matches [226839] (35 species)
    not a true protein
  7. 1373429Species Human (Homo sapiens) [TaxId:9606] [224896] (31 PDB entries)
  8. 1373453Domain d3fzha2: 3fzh A:189-381 [232216]
    Other proteins in same PDB: d3fzhb_
    automated match to d3l6qa2
    complexed with 3bh

Details for d3fzha2

PDB Entry: 3fzh (more details), 2 Å

PDB Description: Crystal Structures of Hsc70/Bag1 in Complex with Small Molecule Inhibitors
PDB Compounds: (A:) Heat shock cognate 71 kDa protein

SCOPe Domain Sequences for d3fzha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fzha2 c.55.1.0 (A:189-381) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkrk
hkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad
lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea
vaygaavqaails

SCOPe Domain Coordinates for d3fzha2:

Click to download the PDB-style file with coordinates for d3fzha2.
(The format of our PDB-style files is described here.)

Timeline for d3fzha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fzha1
View in 3D
Domains from other chains:
(mouse over for more information)
d3fzhb_