Lineage for d3l6qa2 (3l6q A:205-398)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) 
duplication contains two domains of this fold
Family c.55.1.0: automated matches [227137] (1 protein)
not a true familyProtein automated matches [226839] (35 species)
not a true protein
Species Cryptosporidium parvum [TaxId:353152] [225813] (1 PDB entry) 
Domain d3l6qa2: 3l6q A:205-398 [212742]
automated match to d1ngfa2
complexed with mg, so4
Details for d3l6qa2
PDB Entry: 3l6q (more details), 2.29 Å
PDB Description: crystal structure of the n-terminal domain of hsp70 from cryptosporidium parvum (cgd2_20)
PDB Compounds: (A:) Heat shock 70 (HSP70) proteinSCOPe Domain Sequences for d3l6qa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l6qa2 c.55.1.0 (A:205-398) automated matches {Cryptosporidium parvum [TaxId: 353152]}
gtgernvlifdlgggtfdvslltiedgifevkatagdthlggedfdnrlvefcvqdfkrk
nrgmdlttnaralrrlrtqcerakrtlssstqatieldslyegidysvaisrarfeelca
dyfratlapvekvlkdagmdkrsvhdvvlvggstripkvqaliqeffngkepckainpde
avaygaavqaailn
SCOPe Domain Coordinates for d3l6qa2:
Click to download the PDB-style file with coordinates for d3l6qa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3l6qa2:
- d3l6qa2 is new in SCOPe 2.03-stable
- d3l6qa2 appears in SCOPe 2.04
- d3l6qa2 appears in the current release, SCOPe 2.08
View in 3D
