| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
| Protein automated matches [226839] (49 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [224896] (42 PDB entries) |
| Domain d3fzfa1: 3fzf A:5-188 [232212] Other proteins in same PDB: d3fzfb_ automated match to d3l6qa1 complexed with atp |
PDB Entry: 3fzf (more details), 2.2 Å
SCOPe Domain Sequences for d3fzfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fzfa1 c.55.1.0 (A:5-188) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnpt
ntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssmvl
tkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaiayg
ldkk
Timeline for d3fzfa1: