Lineage for d1czyb1 (1czy B:350-501)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1115788Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1115789Superfamily b.8.1: TRAF domain-like [49599] (2 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. 1115790Family b.8.1.1: MATH domain [49600] (4 proteins)
  6. 1115806Protein TNF receptor associated factor 2 (TRAF2) [49601] (1 species)
  7. 1115807Species Human (Homo sapiens) [TaxId:9606] [49602] (10 PDB entries)
  8. 1115809Domain d1czyb1: 1czy B:350-501 [23221]
    Other proteins in same PDB: d1czya2, d1czyb2, d1czyc2

Details for d1czyb1

PDB Entry: 1czy (more details), 2 Å

PDB Description: crystal structure of the complex between the traf domain of human traf2 and an lmp1 binding peptide
PDB Compounds: (B:) tumor necrosis factor receptor associated protein 2

SCOPe Domain Sequences for d1czyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1czyb1 b.8.1.1 (B:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]}
ydgvfiwkisdfprkrqeavagripaifspafytsrygykmclriylngdgtgrgthlsl
ffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvtsssfqrpvndmniasgc
plfcpvskmeaknsyvrddaifikaivdltgl

SCOPe Domain Coordinates for d1czyb1:

Click to download the PDB-style file with coordinates for d1czyb1.
(The format of our PDB-style files is described here.)

Timeline for d1czyb1: