SCOP 1.75: Domain d1dcec2: 1dce C:242-350

Lineage for d1dcec2 (1dce C:242-350)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.4: Rab geranylgeranyltransferase alpha-subunit, insert domain [49594] (1 family)

5. Family b.7.4.1: Rab geranylgeranyltransferase alpha-subunit, insert domain [49595] (1 protein)

6. Protein Rab geranylgeranyltransferase alpha-subunit, insert domain [49596] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [49597] (2 PDB entries)

8. Domain d1dcec2: 1dce C:242-350 [23219]
   Other proteins in same PDB: d1dcea1, d1dcea3, d1dceb_, d1dcec1, d1dcec3, d1dced_
   complexed with zn

Details for d1dcec2

PDB Entry: 1dce, 2 Å

PDB Description: crystal structure of rab geranylgeranyltransferase from rat brain

PDB Compounds: (C:) protein (rab geranylgeranyltransferase alpha subunit)

SCOP Domain Sequences for d1dcec2:

Sequence; same for both SEQRES and ATOM records:

>d1dcec2 b.7.4.1 (C:242-350) Rab geranylgeranyltransferase alpha-subunit, insert domain {Rat (Rattus norvegicus) [TaxId: 10116]}
hdvlccvhvsreeaclsvcfsrpltvgsrmgtlllmvdeaplsvewrtpdgrnrpshvwl
cdlpaaslndqlpqhtfrviwtgsdsqkecvllkdrpecwcrdsatdeq

Timeline for d1dcec2:

• d1dcec2 first appeared (with stable ids) in SCOP 1.55
  
• d1dcec2 appears in SCOP 1.73
  
• d1dcec2 appears in SCOPe 2.01
  
• d1dcec2 appears in the current release, SCOPe 2.08