Lineage for d1dcec2 (1dce C:241-350)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11282Fold b.7: C2 domain-like [49561] (4 superfamilies)
  4. 11376Superfamily b.7.4: Rab geranylgeranyltransferase alpha-subunit, insert domain [49594] (1 family) (S)
  5. 11377Family b.7.4.1: Rab geranylgeranyltransferase alpha-subunit, insert domain [49595] (1 protein)
  6. 11378Protein Rab geranylgeranyltransferase alpha-subunit, insert domain [49596] (1 species)
  7. 11379Species Rat (Rattus norvegicus) [TaxId:10116] [49597] (1 PDB entry)
  8. 11381Domain d1dcec2: 1dce C:241-350 [23219]
    Other proteins in same PDB: d1dcea1, d1dcea3, d1dceb_, d1dcec1, d1dcec3, d1dced_

Details for d1dcec2

PDB Entry: 1dce (more details), 2 Å

PDB Description: crystal structure of rab geranylgeranyltransferase from rat brain

SCOP Domain Sequences for d1dcec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dcec2 b.7.4.1 (C:241-350) Rab geranylgeranyltransferase alpha-subunit, insert domain {Rat (Rattus norvegicus)}
phdvlccvhvsreeaclsvcfsrpltvgsrmgtlllmvdeaplsvewrtpdgrnrpshvw
lcdlpaaslndqlpqhtfrviwtgsdsqkecvllkdrpecwcrdsatdeq

SCOP Domain Coordinates for d1dcec2:

Click to download the PDB-style file with coordinates for d1dcec2.
(The format of our PDB-style files is described here.)

Timeline for d1dcec2: