SCOPe 2.08: Domain d3fdwa_: 3fdw A:

Lineage for d3fdwa_ (3fdw A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families)
   two constituent families are related by circular permutation

5. Family b.7.1.0: automated matches [191388] (1 protein)
   not a true family

6. Protein automated matches [190497] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188711] (30 PDB entries)

8. Domain d3fdwa_: 3fdw A: [232160]
   automated match to d1v27a_

Details for d3fdwa_

PDB Entry: 3fdw, 2.2 Å

PDB Description: crystal structure of a c2 domain from human synaptotagmin-like protein 4

PDB Compounds: (A:) Synaptotagmin-like protein 4

SCOPe Domain Sequences for d3fdwa_:

Sequence; same for both SEQRES and ATOM records:

>d3fdwa_ b.7.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ifvtgriafslkyeqqtqslvvhvkechqlayadeakkrsnpyvktyllpdksrqgkrkt
sikrdtvnplydetlryeipesllaqrtlqfsvwhhgrfgrntflgeaeiqmdswkldkk
ldhclplhgk

Timeline for d3fdwa_:

• d3fdwa_ first appeared in SCOPe 2.03
  
• d3fdwa_ appears in SCOPe 2.07