Lineage for d3ewqa_ (3ewq A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1371237Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. 1371238Superfamily c.50.1: Macro domain-like [52949] (3 families) (S)
  5. 1371320Family c.50.1.0: automated matches [191326] (1 protein)
    not a true family
  6. 1371321Protein automated matches [190146] (6 species)
    not a true protein
  7. 1371328Species Human coronavirus 229E [TaxId:11137] [225531] (2 PDB entries)
  8. 1371330Domain d3ewqa_: 3ewq A: [232126]
    automated match to d3ejga_

Details for d3ewqa_

PDB Entry: 3ewq (more details), 2.1 Å

PDB Description: HCov-229E Nsp3 ADRP domain
PDB Compounds: (A:) non-structural protein 3

SCOPe Domain Sequences for d3ewqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ewqa_ c.50.1.0 (A:) automated matches {Human coronavirus 229E [TaxId: 11137]}
keklnaflvhdnvafyqgdvdtvvngvdfdfivnaanenlahggglakaldvytkgklqr
lskehiglagkvkvgtgvmvecdslrifnvvgprkgkherdllikayntinneqgtpltp
ilscgifgikletslevlldvcntkevkvfvytdtevckvkdfvsgl

SCOPe Domain Coordinates for d3ewqa_:

Click to download the PDB-style file with coordinates for d3ewqa_.
(The format of our PDB-style files is described here.)

Timeline for d3ewqa_: