SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3ewqa_ (3ewq A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120592Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. 2120593Superfamily c.50.1: Macro domain-like [52949] (4 families) (S)
  5. 2120748Family c.50.1.0: automated matches [191326] (1 protein)
    not a true family
  6. 2120749Protein automated matches [190146] (11 species)
    not a true protein
  7. 2120766Species Human coronavirus 229E [TaxId:11137] [225531] (3 PDB entries)
  8. 2120769Domain d3ewqa_: 3ewq A: [232126]
    automated match to d3ejga_

Details for d3ewqa_

PDB Entry: 3ewq (more details), 2.1 Å

PDB Description: HCov-229E Nsp3 ADRP domain
PDB Compounds: (A:) non-structural protein 3

SCOPe Domain Sequences for d3ewqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ewqa_ c.50.1.0 (A:) automated matches {Human coronavirus 229E [TaxId: 11137]}
keklnaflvhdnvafyqgdvdtvvngvdfdfivnaanenlahggglakaldvytkgklqr
lskehiglagkvkvgtgvmvecdslrifnvvgprkgkherdllikayntinneqgtpltp
ilscgifgikletslevlldvcntkevkvfvytdtevckvkdfvsgl

SCOPe Domain Coordinates for d3ewqa_:

Click to download the PDB-style file with coordinates for d3ewqa_.
(The format of our PDB-style files is described here.)

Timeline for d3ewqa_: