Lineage for d3etra1 (3etr A:2-92)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1894040Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1894211Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 1894368Protein automated matches [231466] (4 species)
    not a true protein
  7. 1894369Species Cow (Bos taurus) [TaxId:9913] [232069] (9 PDB entries)
  8. 1894382Domain d3etra1: 3etr A:2-92 [232072]
    Other proteins in same PDB: d3etra2, d3etrb1, d3etrb2, d3etrc1, d3etrc2, d3etrl2, d3etrm1, d3etrm2, d3etrn1, d3etrn2
    automated match to d3etrl1
    complexed with ca, fad, fes, luz, mos, mte

Details for d3etra1

PDB Entry: 3etr (more details), 2.2 Å

PDB Description: crystal structure of xanthine oxidase in complex with lumazine
PDB Compounds: (A:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3etra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3etra1 d.15.4.2 (A:2-92) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl
qdkiihfsanaclapictlhhvavttvegig

SCOPe Domain Coordinates for d3etra1:

Click to download the PDB-style file with coordinates for d3etra1.
(The format of our PDB-style files is described here.)

Timeline for d3etra1: