SCOPe 2.05: Domain d3etrm1: 3etr M:224-414

Lineage for d3etrm1 (3etr M:224-414)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families)

5. Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
   automatically mapped to Pfam PF00941

6. Protein automated matches [232070] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [232074] (10 PDB entries)

8. Domain d3etrm1: 3etr M:224-414 [232076]
   Other proteins in same PDB: d3etra1, d3etra2, d3etrb2, d3etrc1, d3etrc2, d3etrl1, d3etrl2, d3etrm2, d3etrn1, d3etrn2
   automated match to d3b9jb2
   complexed with ca, fad, fes, luz, mos, mte

Details for d3etrm1

PDB Entry: 3etr, 2.2 Å

PDB Description: crystal structure of xanthine oxidase in complex with lumazine

PDB Compounds: (M:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3etrm1:

Sequence; same for both SEQRES and ATOM records:

>d3etrm1 d.145.1.3 (M:224-414) automated matches {Cow (Bos taurus) [TaxId: 9913]}
pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw
ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk
svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei
llsieipysre

Timeline for d3etrm1:

• d3etrm1 first appeared in SCOPe 2.03
  
• d3etrm1 appears in SCOPe 2.04
  
• d3etrm1 appears in SCOPe 2.06
  
• d3etrm1 appears in the current release, SCOPe 2.08