Lineage for d3dpaa2 (3dpa A:125-218)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773151Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) (S)
  5. 2773152Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)
  6. 2773205Protein PapD [49586] (1 species)
  7. 2773206Species Escherichia coli [TaxId:562] [49587] (15 PDB entries)
  8. 2773228Domain d3dpaa2: 3dpa A:125-218 [23205]
    Other proteins in same PDB: d3dpaa1
    CA-atoms only

Details for d3dpaa2

PDB Entry: 3dpa (more details)

PDB Description: crystal structure of chaperone protein papd reveals an immunoglobulin fold
PDB Compounds: (A:) chaperone protein papd

SCOPe Domain Sequences for d3dpaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dpaa2 b.7.2.1 (A:125-218) PapD {Escherichia coli [TaxId: 562]}
nevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqtvksa
nyntpylsyindyggrpvlsficngsrcsvkkek

SCOPe Domain Coordinates for d3dpaa2:

Click to download the PDB-style file with coordinates for d3dpaa2.
(The format of our PDB-style files is described here.)

Timeline for d3dpaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3dpaa1