PDB entry 3dpa

View 3dpa on RCSB PDB site
Description: crystal structure of chaperone protein papd reveals an immunoglobulin fold
Class: chaperone protein
Keywords: chaperone protein
Deposited on 1991-10-09, released 1991-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chaperone protein papd
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15319 (0-217)
      • conflict (59)
    Domains in SCOPe 2.08: d3dpaa1, d3dpaa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3dpaA (A:)
avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrld
pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai
ktrpnevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqt
vksanyntpylsyindyggrpvlsficngsrcsvkkek