SCOPe 2.03: Domain d1qppb2: 1qpp B:125-214

Lineage for d1qppb2 (1qpp B:125-214)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families)

5. Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)

6. Protein PapD [49586] (1 species)

7. Species Escherichia coli [TaxId:562] [49587] (14 PDB entries)

8. Domain d1qppb2: 1qpp B:125-214 [23203]
   Other proteins in same PDB: d1qppa1, d1qppb1

Details for d1qppb2

PDB Entry: 1qpp, 2.6 Å

PDB Description: crystal structures of self capping papd chaperone homodimers

PDB Compounds: (B:) papd chaperone

SCOPe Domain Sequences for d1qppb2:

Sequence; same for both SEQRES and ATOM records:

>d1qppb2 b.7.2.1 (B:125-214) PapD {Escherichia coli [TaxId: 562]}
nevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqtvksa
nyntpylsyindyggrpvlsficngsrcsv

Timeline for d1qppb2:

• d1qppb2 first appeared (with stable ids) in SCOP 1.55
  
• d1qppb2 appears in SCOPe 2.02
  
• d1qppb2 appears in SCOPe 2.04
  
• d1qppb2 appears in the current release, SCOPe 2.08